BANP Peptide - N-terminal region
BANP Peptide - N-terminal region
Product Specifications
UniProt
D3DUN6
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BANP Rabbit Polyclonal Antibody (orb575242) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VVQIAVEDLSPDHPVVLENHVVTDEDEPALKRQRLEINCQDPSIKSFLYS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-E925830-25G 25 g
Ethyl 3-Oxo-4-(2,4,5-trifluorophenyl)butanoate
Sign In for Pricing
View Details 
PKSM040950 100 µg
Recombinant Mouse IL13RA2/CD213A2 Protein (His & Fc Tag)
Sign In for Pricing
View Details