ZMYM6 Peptide - N-terminal region
ZMYM6 Peptide - N-terminal region
Product Specifications
UniProt
O95789
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZMYM6 Rabbit Polyclonal Antibody (orb575305) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QELLDKIKEEPDNAQEYGCVQQPKTQESKLKIGGVSSVNERPIAQQLNPG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC050391-100 1x 100 µL
CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680676-500 1x 500 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742075-100 1x 100 µL
MyoD1 (Rhabdomyosarcoma Marker) (MYOD1/2075R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details