Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC2A4RG Peptide - C-terminal region

SLC2A4RG Peptide - C-terminal region

Product Specifications

UniProt

Q9NR83

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC2A4RG Rabbit Polyclonal Antibody (orb577097) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HSDRVYQGCLTPARLEPQPTEVGACPPALSSRIGVTLRKPRGDAKKCRKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSPAN14 Over-expression Lysate Product
GWB-4EAF32 0.1 mg

TSPAN14 Over-expression Lysate Product

Sign In for Pricing
View Details
GGT6 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV675705 1.0 µg DNA

GGT6 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Guinea Pig Glicentin ELISA Kit
MBS7276736-01 48 Well

Guinea Pig Glicentin ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Glicentin ELISA Kit
MBS7276736-02 96 Well

Guinea Pig Glicentin ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Glicentin ELISA Kit
MBS7276736-03 5x 96 Well

Guinea Pig Glicentin ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Glicentin ELISA Kit
MBS7276736-04 10x 96 Well

Guinea Pig Glicentin ELISA Kit

Sign In for Pricing
View Details