Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXA11 Peptide - C-terminal region

HOXA11 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HOX1, HOX1I

UniProt

P31270

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HOXA11 Rabbit Polyclonal Antibody (orb577146) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005514

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FFSVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKINRDRLQYYSAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Polyclonal SOD2/Mn-SOD Antibody [Alexa Fluor 700]
NB200-165AF700 0.1 mL

Goat Polyclonal SOD2/Mn-SOD Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
GNB2L1, 1-317aa, Human, His tag, E.coli
E53A02290 50 µg

GNB2L1, 1-317aa, Human, His tag, E.coli

Sign In for Pricing
View Details
F (ab') 2 Rat IgG (H&L) Antibody
orb348355 1 mg

F (ab') 2 Rat IgG (H&L) Antibody

Sign In for Pricing
View Details
Alfa Human Antibody
orb2975938-01 100 µg

Alfa Human Antibody

Sign In for Pricing
View Details
Alfa Human Antibody
orb2975938-02 1 mg

Alfa Human Antibody

Sign In for Pricing
View Details
Chicken Active breakpoint cluster region-related protein (ABR) ELISA Kit
MBS7208895-01 48 Well

Chicken Active breakpoint cluster region-related protein (ABR) ELISA Kit

Sign In for Pricing
View Details