Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXA11 Peptide - C-terminal region

HOXA11 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HOX1, HOX1I

UniProt

P31270

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HOXA11 Rabbit Polyclonal Antibody (orb577146) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005514

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FFSVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKINRDRLQYYSAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABI3BP Antibody
orb252604 100 µL

ABI3BP Antibody

Sign In for Pricing
View Details
Recombinant Legionella Pneumophila frr Protein (aa 1-185) (strain Lens)
VAng-Lsx04329-500gEcoli 500 µg (E. coli)

Recombinant Legionella Pneumophila frr Protein (aa 1-185) (strain Lens)

Sign In for Pricing
View Details
Anti-Sp7/Osterix Antibody Picoband® Fluoro488 Conjugated
A02077-1-Fluoro488 100 µg/Vial

Anti-Sp7/Osterix Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Bcl-x (BX006), CF594 conjugate, 0.1mg/mL
BNC940006-100 1x 100 µL

Bcl-x (BX006), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Potassium Glycerophosphate - 75% solution
FP09654-01 50 g

Potassium Glycerophosphate - 75% solution

Sign In for Pricing
View Details
Potassium Glycerophosphate - 75% solution
FP09654-02 100 g

Potassium Glycerophosphate - 75% solution

Sign In for Pricing
View Details