Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOSC3 Peptide - C-terminal region

EXOSC3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PCH1B, RP11-3J10.8, RRP40, Rrp40p, bA3J10.7, hRrp-40, p10

UniProt

Q9NQT5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EXOSC3 Rabbit Polyclonal Antibody (orb324905) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057126

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OSBP2 Rabbit Polyclonal Antibody
TA361666 100 µL

OSBP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DL-Glutamic Acid-d5
TRC-G596957-25MG 25 mg

DL-Glutamic Acid-d5

Sign In for Pricing
View Details
Lmx1a Rabbit Polyclonal Antibody
AP11391PU-N 400 µL

Lmx1a Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ADH1B Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H7]
TA502776AM 100 µL

ADH1B Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H7]

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS642730 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
FUS Human Gene Knockout Kit (CRISPR)
KN401808 1 Kit

FUS Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details