EXOSC3 Peptide - C-terminal region
EXOSC3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
PCH1B, RP11-3J10.8, RRP40, Rrp40p, bA3J10.7, hRrp-40, p10
UniProt
Q9NQT5
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EXOSC3 Rabbit Polyclonal Antibody (orb324905) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_057126
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
#30001 1x 1 mL
JC-1 Mitochondrial Membrane Potential Detection Kit (100 assays)
Sign In for Pricing
View Details 
BNC402309-100 1x 100 µL
NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/1523), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
