Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prkcd Peptide - N-terminal region

Prkcd Peptide - N-terminal region

Product Specifications

UniProt

Q80UN7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRKCD Rabbit Polyclonal Antibody (orb583272) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NSYELGSLQVEDEASQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKTTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alexa Fluor® 488 anti-human CD54
E16FHG054-100 100 Tests

Alexa Fluor® 488 anti-human CD54

Sign In for Pricing
View Details
Lentiviral human PTK2B shRNA (UAS) - Lentiviral human PTK2B shRNA (UAS, iRFP) (100)
GTR15152259 1 Vial

Lentiviral human PTK2B shRNA (UAS) - Lentiviral human PTK2B shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Recombinant Rat PLAA Protein, His (Fc)-Avi-tagged
PLAA-4151R 50 µg

Recombinant Rat PLAA Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Mouse Monoclonal CD4 Antibody (OTI5D9) [Alexa Fluor 405]
NBP2-70357AF405 0.1 mL

Mouse Monoclonal CD4 Antibody (OTI5D9) [Alexa Fluor 405]

Sign In for Pricing
View Details
4-Pyridinecarbonitrile
P0620-01 100 g

4-Pyridinecarbonitrile

Sign In for Pricing
View Details
4-Pyridinecarbonitrile
P0620-02 500 g

4-Pyridinecarbonitrile

Sign In for Pricing
View Details