PPIAL4C Peptide - C-terminal region
PPIAL4C Peptide - C-terminal region
Product Specifications
UniProt
Q9Y536
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PPIAL4C Rabbit Polyclonal Antibody (orb327083) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_003846538
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NGSQFFICAAKTEWLDGKHVAFGKVKERVNIVEAMEHFGYRNSKTSKKIT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY427257 100 µg
RIPX (RUFY3) (NM_001130709) Human Over-expression Lysate
Sign In for Pricing
View Details 
HA750402 100 µL
Vitamin D Receptor Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details 
MC26F-aR 10x 96 Well Plates
Goat anti-Rabbit IgG Coated - 96 well Solid plates - Clear PS
Sign In for Pricing
View Details