PPIAL4C Peptide - C-terminal region
PPIAL4C Peptide - C-terminal region
Product Specifications
UniProt
Q9Y536
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PPIAL4C Rabbit Polyclonal Antibody (orb327083) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_003846538
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NGSQFFICAAKTEWLDGKHVAFGKVKERVNIVEAMEHFGYRNSKTSKKIT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC682809-100 1x 100 µL
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/2809R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
P002-405L-125 1x 125 µL
CD3e Mouse Monoclonal Antibody (SK7), CF®405L Conjugate - Biotium Choice
Sign In for Pricing
View Details 
BNUM1779-50 1x 50 µL
CD8A (Cytotoxic- & Suppressor T-Cell Marker) (C8/1779R), 1mg/mL
Sign In for Pricing
View Details