Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIEF2 Peptide - N-terminal region

MIEF2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MID49, SMCR7

UniProt

Q96C03

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MIEF2 Rabbit Polyclonal Antibody (orb587750) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_683684

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FSQKRGKRRSDEGLGSMVDFLLANARLVLGVGGAAVLGIATLAVKRFIDR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant C1QBP Antibody
RC-4495-01 50 μL

Recombinant C1QBP Antibody

Sign In for Pricing
View Details
Recombinant C1QBP Antibody
RC-4495-02 100 µL

Recombinant C1QBP Antibody

Sign In for Pricing
View Details
Recombinant C1QBP Antibody
RC-4495-03 1 mL

Recombinant C1QBP Antibody

Sign In for Pricing
View Details
Recombinant Mouse IL18R1/CD218a Protein (His Tag)
PKSM040867-01 100 µg

Recombinant Mouse IL18R1/CD218a Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL18R1/CD218a Protein (His Tag)
PKSM040867-02 1 mg

Recombinant Mouse IL18R1/CD218a Protein (His Tag)

Sign In for Pricing
View Details
Stachyose Hydrate
TRC-S684480-250MG 250 mg

Stachyose Hydrate

Sign In for Pricing
View Details