SNRNP40 Peptide - middle region
SNRNP40 Peptide - middle region
Product Specifications
Product Name Alternative
40K, HPRP8BP, PRP8BP, PRPF8BP, RP11-490K7.3, SPF38, WDR57
UniProt
Q96DI7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SNRNP40 Rabbit Polyclonal Antibody (orb587753) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_004805
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-F792578-1MG 1 mg
D-Fructose 6-Phosphate-13C6 Sodium Salt Hydrate
Sign In for Pricing
View Details 
E-BC-K235-S-01 50 Assays (19 samples)
Alanine Aminotransferase (ALT/GPT) Activity Assay Kit
Sign In for Pricing
View Details E-BC-K235-S-02 100 Assays (44 samples)
Alanine Aminotransferase (ALT/GPT) Activity Assay Kit
Sign In for Pricing
View Details 
BNC473771-100 1x 100 µL
Ferritin, Light Chain (Node-Negative Breast Tumor Prognostic Marker) (rFTL/1388), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
