SNRNP40 Peptide - middle region
SNRNP40 Peptide - middle region
Product Specifications
Product Name Alternative
40K, HPRP8BP, PRP8BP, PRPF8BP, RP11-490K7.3, SPF38, WDR57
UniProt
Q96DI7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SNRNP40 Rabbit Polyclonal Antibody (orb587753) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_004805
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-E677342-250MG 250 mg
Des-N-pyrrolindinyl-N-ethyl PV8 Hydrochloride
Sign In for Pricing
View Details 
HA722951 100 µL
Phospho-AKT (T308) Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details 
