Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPDYE2B Peptide - N-terminal region

SPDYE2B Peptide - N-terminal region

Product Specifications

UniProt

A6NHP3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPDYE2B Rabbit Polyclonal Antibody (orb587754) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001159811

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GKITTSRQPHPQNEQSPQRSTSGYPLQEVVDDEMLGPSAPGVDPSPPCRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR13 siRNA (Mouse)
orb1840288-01 15 nmol

WDR13 siRNA (Mouse)

Sign In for Pricing
View Details
WDR13 siRNA (Mouse)
orb1840288-02 30 nmol

WDR13 siRNA (Mouse)

Sign In for Pricing
View Details
Claudin 5 Polyclonal Antibody
RD70355A-01 60 μL

Claudin 5 Polyclonal Antibody

Sign In for Pricing
View Details
Claudin 5 Polyclonal Antibody
RD70355A-02 120 μL

Claudin 5 Polyclonal Antibody

Sign In for Pricing
View Details
Claudin 5 Polyclonal Antibody
RD70355A-03 200 µL

Claudin 5 Polyclonal Antibody

Sign In for Pricing
View Details
Duck Glypican 6 (GPC6) ELISA Kit
MBS9366628 Inquire

Duck Glypican 6 (GPC6) ELISA Kit

Sign In for Pricing
View Details