Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPDYE2B Peptide - N-terminal region

SPDYE2B Peptide - N-terminal region

Product Specifications

UniProt

A6NHP3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPDYE2B Rabbit Polyclonal Antibody (orb587754) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001159811

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GKITTSRQPHPQNEQSPQRSTSGYPLQEVVDDEMLGPSAPGVDPSPPCRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ammonium Citrate, Dibasic
B2023877 500 g

Ammonium Citrate, Dibasic

Sign In for Pricing
View Details
BFP Protein (N-His, other)
P522341 100 µg

BFP Protein (N-His, other)

Sign In for Pricing
View Details
Human RNASE13 shRNA Plasmid
abx968240-01 150 µg

Human RNASE13 shRNA Plasmid

Sign In for Pricing
View Details
Human RNASE13 shRNA Plasmid
abx968240-02 300 µg

Human RNASE13 shRNA Plasmid

Sign In for Pricing
View Details
N-{1-[ (2-Bromophenyl) methyl]-1H-pyrazol-5-yl}-2-chloroacetamide
DXC59720-01 50 mg

N-{1-[ (2-Bromophenyl) methyl]-1H-pyrazol-5-yl}-2-chloroacetamide

Sign In for Pricing
View Details
N-{1-[ (2-Bromophenyl) methyl]-1H-pyrazol-5-yl}-2-chloroacetamide
DXC59720-02 0.5 g

N-{1-[ (2-Bromophenyl) methyl]-1H-pyrazol-5-yl}-2-chloroacetamide

Sign In for Pricing
View Details