Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPDYE2B Peptide - C-terminal region

SPDYE2B Peptide - C-terminal region

Product Specifications

UniProt

A6NHP3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPDYE2B Rabbit Polyclonal Antibody (orb587755) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SMNPRARKNRSRIPLLRKRRFQLYRSTNPRARKNRSRIPLLRKRRFQLYR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1964), CF740 conjugate, 0.1mg/mL
BNC741964-100 1x 100 µL

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1964), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), CF647 conjugate, 0.1mg/mL
BNC471577-500 1x 500 µL

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mix-n-StainTM Maxi FITC Antibody Labeling Kit, 1x1mg labeling
#92411 1 Kit

Mix-n-StainTM Maxi FITC Antibody Labeling Kit, 1x1mg labeling

Sign In for Pricing
View Details
ZNF217 Human Gene Knockout Kit (CRISPR)
KN424371 1 Kit

ZNF217 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BubR1 (BUB1B) (NM_001211) Human Over-expression Lysate
LY420068 100 µg

BubR1 (BUB1B) (NM_001211) Human Over-expression Lysate

Sign In for Pricing
View Details
EIF4EBP1 Mouse Monoclonal Antibody [Clone ID: 9E12D9]
AM06148SU-N 100 µL

EIF4EBP1 Mouse Monoclonal Antibody [Clone ID: 9E12D9]

Sign In for Pricing
View Details