Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPDYE2B Peptide - C-terminal region

SPDYE2B Peptide - C-terminal region

Product Specifications

UniProt

A6NHP3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPDYE2B Rabbit Polyclonal Antibody (orb587755) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SMNPRARKNRSRIPLLRKRRFQLYRSTNPRARKNRSRIPLLRKRRFQLYR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Drosopterin
TRC-D689450-10MG 10 mg

Drosopterin

Sign In for Pricing
View Details
TCF4 (NM_001083962) Human Over-expression Lysate
LY421261 100 µg

TCF4 (NM_001083962) Human Over-expression Lysate

Sign In for Pricing
View Details
IL 3 Rat
OM296574-01 20 µg

IL 3 Rat

Sign In for Pricing
View Details
IL 3 Rat
OM296574-02 5 µg

IL 3 Rat

Sign In for Pricing
View Details
IL 3 Rat
OM296574-03 1 mg

IL 3 Rat

Sign In for Pricing
View Details
C12orf40 Polyclonal Antibody
E-AB-18554-01 20 µL

C12orf40 Polyclonal Antibody

Sign In for Pricing
View Details