SPSB3 Peptide - C-terminal region
SPSB3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
C16orf31, SSB3
UniProt
Q6PJ21
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SPSB3 Rabbit Polyclonal Antibody (orb327111) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_543137
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PGLKQVLHNKLGWVLSMSCSRRKAPVSDPQAATSAHPSSREPRPCQRKRC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP311740L 1 mg
PDGF Receptor alpha (PDGFRA) (NM_006206) Human Recombinant Protein
Sign In for Pricing
View Details ![Phospho-MEK1/2 (S218 + S222) Recombinant Rabbit Monoclonal Antibody [ST0490]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea8117c/imageurl/et1609-50.webp)
ET1609-50 100 µL
Phospho-MEK1/2 (S218 + S222) Recombinant Rabbit Monoclonal Antibody [ST0490]
Sign In for Pricing
View Details 
GAF-003-15 1 mL
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human IgM, 15nm
Sign In for Pricing
View Details