SPSB3 Peptide - C-terminal region
SPSB3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
C16orf31, SSB3
UniProt
Q6PJ21
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SPSB3 Rabbit Polyclonal Antibody (orb327111) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_543137
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PGLKQVLHNKLGWVLSMSCSRRKAPVSDPQAATSAHPSSREPRPCQRKRC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC942531-100 1x 100 µL
P73 (Tumor Suppressor) (P73/2531), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LC403087 20 µg
Apolipoprotein L 2 (APOL2) (NM_030882) Human Over-expression Lysate
Sign In for Pricing
View Details 
HA723378 100 µL
Human CCL3 / MIP-1 alpha Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details 
