Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAC3 Peptide - C-terminal region

STAC3 Peptide - C-terminal region

Product Specifications

UniProt

Q96MF2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STAC3 Rabbit Polyclonal Antibody (orb587759) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659501

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RPEEGKPQDGNPEGDKKAEKKTPDDKHKQPGFQQSHYFVALYRFKALEKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C18-BIO5μm2.1 x 200mm
HCA050U021X20078A 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

C18-BIO5μm2.1 x 200mm

Sign In for Pricing
View Details
FIBIN Rabbit pAb
orb2711589-01 50 µL

FIBIN Rabbit pAb

Sign In for Pricing
View Details
FIBIN Rabbit pAb
orb2711589-02 100 µL

FIBIN Rabbit pAb

Sign In for Pricing
View Details
Human myeloperoxidase, MPO ELISA KIT
E0880Hu-01 48 Well

Human myeloperoxidase, MPO ELISA KIT

Sign In for Pricing
View Details
Human myeloperoxidase, MPO ELISA KIT
E0880Hu-02 96 Well

Human myeloperoxidase, MPO ELISA KIT

Sign In for Pricing
View Details
Human myeloperoxidase, MPO ELISA KIT
E0880Hu-03 5x 96 Tests

Human myeloperoxidase, MPO ELISA KIT

Sign In for Pricing
View Details