TARSL2 Peptide - C-terminal region
TARSL2 Peptide - C-terminal region
Product Specifications
UniProt
A2RTX5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TARSL2 Rabbit Polyclonal Antibody (orb587760) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_689547
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TYVSKDGDDKKRPVIIHRAILGSVERMIAILSENYGGKWPFWLSPRQVMV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AG-006-2 2 mL
Pure Rabbit Anti-Goat IgG Gel Specific Immobilized Antibodies
Sign In for Pricing
View Details 
E-BC-K152-M-01 48 T (46 samples)
Mitochondrial Complex IV (Cytochrome C Oxidase) Activity Assay Kit
Sign In for Pricing
View Details E-BC-K152-M-02 96 T (94 samples)
Mitochondrial Complex IV (Cytochrome C Oxidase) Activity Assay Kit
Sign In for Pricing
View Details