Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TARSL2 Peptide - C-terminal region

TARSL2 Peptide - C-terminal region

Product Specifications

UniProt

A2RTX5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TARSL2 Rabbit Polyclonal Antibody (orb587760) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689547

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TYVSKDGDDKKRPVIIHRAILGSVERMIAILSENYGGKWPFWLSPRQVMV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEC1 (NDC80) Rabbit Monoclonal Antibody
TA423163 100 µL

HEC1 (NDC80) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
RWDD3 (NM_001128142) Human Recombinant Protein
TP325219M 100 µg

RWDD3 (NM_001128142) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Mouse S100A15/S100A7A Protein (His & MBP Tag)
PKSM040795 50 µg

Recombinant Mouse S100A15/S100A7A Protein (His & MBP Tag)

Sign In for Pricing
View Details
Tyrphostin AG 112
TRC-T947980-25MG 25 mg

Tyrphostin AG 112

Sign In for Pricing
View Details
Human CACTIN activation kit by CRISPRa
GA111789 1 Kit

Human CACTIN activation kit by CRISPRa

Sign In for Pricing
View Details
EIF4A2 (NM_001967) Human Recombinant Protein
TP305623M 100 µg

EIF4A2 (NM_001967) Human Recombinant Protein

Sign In for Pricing
View Details