TBC1D3G Peptide - middle region
TBC1D3G Peptide - middle region
Product Specifications
UniProt
F5GYN8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TBC1D3G Rabbit Polyclonal Antibody (orb327114) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_003960735
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HVVATSQPKTMGHQDKKDLCGQCSPLGCLIRILIDGISLGLTLRLWDVYL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC041297-500 1x 500 µL
HPV-18 (Human Papilloma Virus 18) (HPV18/1297), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
RG237080 10 µg
Uroplakin Ia (UPK1A) (NM_001281443) Human Tagged ORF Clone
Sign In for Pricing
View Details 
