Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBC1D3G Peptide - middle region

TBC1D3G Peptide - middle region

Product Specifications

UniProt

F5GYN8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBC1D3G Rabbit Polyclonal Antibody (orb327114) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_003960735

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HVVATSQPKTMGHQDKKDLCGQCSPLGCLIRILIDGISLGLTLRLWDVYL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histatin 1 (HTN1) (NM_002159) Human Over-expression Lysate
LY419495 100 µg

Histatin 1 (HTN1) (NM_002159) Human Over-expression Lysate

Sign In for Pricing
View Details
L-Alanine 2-Ethylbutyl Ester Hydrochloride
TRC-A195220-5G 5 g

L-Alanine 2-Ethylbutyl Ester Hydrochloride

Sign In for Pricing
View Details
Mouse AR (Amphiregulin) CLIA Kit
E-CL-M0472-01 24 Tests

Mouse AR (Amphiregulin) CLIA Kit

Sign In for Pricing
View Details
Mouse AR (Amphiregulin) CLIA Kit
E-CL-M0472-02 48 Tests

Mouse AR (Amphiregulin) CLIA Kit

Sign In for Pricing
View Details
Mouse AR (Amphiregulin) CLIA Kit
E-CL-M0472-03 96 Tests

Mouse AR (Amphiregulin) CLIA Kit

Sign In for Pricing
View Details
Human METTL21C activation kit by CRISPRa
GA116284 1 Kit

Human METTL21C activation kit by CRISPRa

Sign In for Pricing
View Details