TBKBP1 Peptide - N-terminal region
TBKBP1 Peptide - N-terminal region
Product Specifications
UniProt
D3DTT5
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TBKBP1 Rabbit Polyclonal Antibody (orb587766) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ELQKNKEQEEQLGEMIQAYEKLCVEKSDLETELREMRALVETHLRQICGL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040225-100 1x 100 µL
Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880050-500 1x 500 µL
IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040745-100 1x 100 µL
CD45 / LCA (2B11 + PD7/26), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400633-100 1x 100 µL
Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details