Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TDRD12 Peptide - C-terminal region

TDRD12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ECAT8

UniProt

Q587J7

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TDRD12 Rabbit Polyclonal Antibody (orb327115) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001104292

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DKAVKCNMDSLRDSPKDKSEKKHHCISLKDTNKRVESSVYWPAKRGITIY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMPRSS11E (Center) Rabbit Polyclonal Antibody
AP54298PU-N 400 µL

TMPRSS11E (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PLGLB1 Rabbit Polyclonal Antibody
TA370274 100 µL

PLGLB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2,3-Dihydro-5-mercapto-3-oxo-4-isothiazolecarboxylic Acid Trisodium Salt
TRC-D452920-50G 50 g

2,3-Dihydro-5-mercapto-3-oxo-4-isothiazolecarboxylic Acid Trisodium Salt

Sign In for Pricing
View Details
LUZP2 (NM_001009909) Human Recombinant Protein
TP321983M 100 µg

LUZP2 (NM_001009909) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: left
CS711759 5x 5 µm

Tissue FFPE Sections, Ovary: left

Sign In for Pricing
View Details
Electric OR table BOPT-105
BOPT-105 1 Unit

Electric OR table BOPT-105

Sign In for Pricing
View Details