TDRD12 Peptide - C-terminal region
TDRD12 Peptide - C-terminal region
Product Specifications
Product Name Alternative
ECAT8
UniProt
Q587J7
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TDRD12 Rabbit Polyclonal Antibody (orb327115) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001104292
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DKAVKCNMDSLRDSPKDKSEKKHHCISLKDTNKRVESSVYWPAKRGITIY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC882385-100 1x 100 µL
CD14 (Monocyte / Macrophage Marker) (LPSR/2385), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![Elab Fluor® 488 Anti-Mouse CD36 Antibody[HM36]](https://cdn.genprice.uk/products/763/68dd14ad061270361e7d33e1/imageurl/e-ab-f1291l.webp)
E-AB-F1291L-01 50 Tests
Elab Fluor® 488 Anti-Mouse CD36 Antibody[HM36]
Sign In for Pricing
View Details E-AB-F1291L-02 100 Tests
Elab Fluor® 488 Anti-Mouse CD36 Antibody[HM36]
Sign In for Pricing
View Details