Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VHLL Peptide - N-terminal region

VHLL Peptide - N-terminal region

Product Specifications

Product Name Alternative

VHLP, VLP

UniProt

Q6RSH7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VHLL Rabbit Polyclonal Antibody (orb587794) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004319

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PWRAGNGVGLEAQAGTQEAGPEEYCQEELGAEEEMAARAAWPVLRSVNSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD47 / IAP (Integrin Associated Protein) Monoclonal Antibody (Clone: CD47/2937)
36-3630-20 20 µg

Anti-CD47 / IAP (Integrin Associated Protein) Monoclonal Antibody (Clone: CD47/2937)

Sign In for Pricing
View Details
Human CD3D Protein, His Tag and Human CD3E Protein, hFc Tag
E33P100730 10 µg

Human CD3D Protein, His Tag and Human CD3E Protein, hFc Tag

Sign In for Pricing
View Details
Lentiviral human CDKN1A shRNA (UAS) - Lentiviral human CDKN1A shRNA (UAS, GFP) plasmid
GTR15344629 1 Vial

Lentiviral human CDKN1A shRNA (UAS) - Lentiviral human CDKN1A shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Hsp90 alpha Antibody: PerCP
MBS804659-01 0.1 mg

Hsp90 alpha Antibody: PerCP

Sign In for Pricing
View Details
Hsp90 alpha Antibody: PerCP
MBS804659-02 5x 0.1 mg

Hsp90 alpha Antibody: PerCP

Sign In for Pricing
View Details
Bovine Thyrotropin Releasing Hormone ELISA kit
GTR10432807 96 Well

Bovine Thyrotropin Releasing Hormone ELISA kit

Sign In for Pricing
View Details