WDR86 Peptide - C-terminal region
WDR86 Peptide - C-terminal region
Product Specifications
UniProt
Q86TI4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with WDR86 Rabbit Polyclonal Antibody (orb327147) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001271189.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SADRTVKCWLADTGECVRTFTAHRRNVSALKYHAGTLFTGSGDACARAFD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSH033694-01 10 µg
Recombinant Human CD69 Protein (aa 64-199, His Tag)
Sign In for Pricing
View Details PKSH033694-02 50 µg
Recombinant Human CD69 Protein (aa 64-199, His Tag)
Sign In for Pricing
View Details 
BNC880416-500 1x 500 µL
Fascin-1 (FSCN1/416), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
0806-3 100 µL
Alkaline Phosphatase (For 4 isoform) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 