ZNF772 Peptide - middle region
ZNF772 Peptide - middle region
Product Specifications
UniProt
Q68DY9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF772 Rabbit Polyclonal Antibody (orb587813) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SFVTGEACKDFLASSSIFEHHAPHNEWKPHSNTKCEEASHCGKRHYKCSE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC942008-500 1x 500 µL
IL-4 (Interleukin-4), Mouse (11B11), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
RD-UBE3A-Hu-01 96 Tests
Human Ubiquitin Protein Ligase E3A (UBE3A) ELISA Kit
Sign In for Pricing
View Details RD-UBE3A-Hu-02 48 Tests
Human Ubiquitin Protein Ligase E3A (UBE3A) ELISA Kit
Sign In for Pricing
View Details