Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF772 Peptide - middle region

ZNF772 Peptide - middle region

Product Specifications

UniProt

Q68DY9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF772 Rabbit Polyclonal Antibody (orb587813) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SFVTGEACKDFLASSSIFEHHAPHNEWKPHSNTKCEEASHCGKRHYKCSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CMAS (NM_018686) Human Over-expression Lysate
LC402711 20 µg

CMAS (NM_018686) Human Over-expression Lysate

Sign In for Pricing
View Details
FSH Receptor (FSHR) Rabbit Polyclonal Antibody
AP23647PU-N 50 µL

FSH Receptor (FSHR) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tmco1 Mouse Gene Knockout Kit (CRISPR)
KN517669 1 Kit

Tmco1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human UGT (UGT1A1) activation kit by CRISPRa
GA110209 1 Kit

Human UGT (UGT1A1) activation kit by CRISPRa

Sign In for Pricing
View Details
PIGF (NM_002643) Human Over-expression Lysate
LC419196 20 µg

PIGF (NM_002643) Human Over-expression Lysate

Sign In for Pricing
View Details
Lupeol
TRC-L474850-50MG 50 mg

Lupeol

Sign In for Pricing
View Details