Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSX2B Peptide - middle region

SSX2B Peptide - middle region

Product Specifications

UniProt

Q16385

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SSX2B Rabbit Polyclonal Antibody (orb327151) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MTFGRLQGISPKIMPKKPAEEGNDSEEVPEASGPQNDGKELCPPGKPTTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD117/KIT Human Monoclonal Antibody
orb2975425-01 50 µg

CD117/KIT Human Monoclonal Antibody

Sign In for Pricing
View Details
CD117/KIT Human Monoclonal Antibody
orb2975425-02 100 µg

CD117/KIT Human Monoclonal Antibody

Sign In for Pricing
View Details
WDR24 Rabbit Polyclonal Antibody
orb632589-01 50 µg

WDR24 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WDR24 Rabbit Polyclonal Antibody
orb632589-02 100 µg

WDR24 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
H-6-Diazo-5-oxo-D-Nle-OH
F-2185.0025 25.0mg

H-6-Diazo-5-oxo-D-Nle-OH

Sign In for Pricing
View Details
ZNF365 Peptide
orb2021088 100 µg

ZNF365 Peptide

Sign In for Pricing
View Details