SSX2B Peptide - middle region
SSX2B Peptide - middle region
Product Specifications
UniProt
Q16385
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SSX2B Rabbit Polyclonal Antibody (orb327151) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MTFGRLQGISPKIMPKKPAEEGNDSEEVPEASGPQNDGKELCPPGKPTTS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRV-0026345 96 Tests
Multiplex Assay Kit for Cytokeratin 15 (CK15), etc. by FLIA (Flow Luminescence Immunoassay)
Sign In for Pricing
View Details