CCDC61 Peptide - C-terminal region
CCDC61 Peptide - C-terminal region
Product Specifications
UniProt
F5GZQ6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CCDC61 Rabbit Polyclonal Antibody (orb587825) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RGKPPSPTPWSGSNMKSPPVERSHHQKSLANSGGWVPIKEYSSEHQAADM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC471214-500 1x 500 µL
Luteinizing Hormone beta (LH beta) (LHb/1214), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TRC-D446830-2.5G 2.5 g
1,3-Difluoro-2-propanol (Stabilized with NaF)
Sign In for Pricing
View Details ![IMP3 Recombinant Rabbit Monoclonal Antibody [JE34-04]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea81087/imageurl/ha721990.webp)
HA721990 100 µL
IMP3 Recombinant Rabbit Monoclonal Antibody [JE34-04]
Sign In for Pricing
View Details 
AN300046P 100 µL
Recombinant Clusterin/Apolipoprotein J/Apo-J/CLU Monoclonal Antibody
Sign In for Pricing
View Details 