CCDC61 Peptide - C-terminal region
CCDC61 Peptide - C-terminal region
Product Specifications
UniProt
F5GZQ6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CCDC61 Rabbit Polyclonal Antibody (orb587825) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RGKPPSPTPWSGSNMKSPPVERSHHQKSLANSGGWVPIKEYSSEHQAADM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![MEK1 (MAP2K1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H3]](https://cdn.genprice.uk/products/937/68dd1b70061270361ea183d5/imageurl/ta505703bm.webp)
TA505703BM 100 µL
MEK1 (MAP2K1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H3]
Sign In for Pricing
View Details 
RD-FPR2-Hu-01 96 Tests
Human Formyl Peptide Receptor 2 (FPR2) ELISA Kit
Sign In for Pricing
View Details RD-FPR2-Hu-02 48 Tests
Human Formyl Peptide Receptor 2 (FPR2) ELISA Kit
Sign In for Pricing
View Details