CD300LF Peptide - middle region
CD300LF Peptide - middle region
Product Specifications
UniProt
Q8TDQ1
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CD300LF Rabbit Polyclonal Antibody (orb587826) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
044256-ML650 100 µL
ZNF503, NT (ZNF503, Zinc finger protein 503) (MaxLight 650) discontinued
Sign In for Pricing
View Details 
MBS9449970-01 0.1 mL (Biotin)
NFkappaB-p100 Polyclonal Conjugated Antibody
Sign In for Pricing
View Details MBS9449970-02 0.1 mL (AF350)
NFkappaB-p100 Polyclonal Conjugated Antibody
Sign In for Pricing
View Details MBS9449970-03 0.1 mL (AF405)
NFkappaB-p100 Polyclonal Conjugated Antibody
Sign In for Pricing
View Details MBS9449970-04 0.1 mL (AF488)
NFkappaB-p100 Polyclonal Conjugated Antibody
Sign In for Pricing
View Details