Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CT47A12 Peptide - C-terminal region

CT47A12 Peptide - C-terminal region

Product Specifications

UniProt

Q5JQC4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CT47A12 Rabbit Polyclonal Antibody (orb327164) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775842

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PTAQEATAPEEVTKSQPEKWDEEAQDAAGEEEKEQEKEKDAENKVKNSKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-NUP188 Antibody, Affinity Purified
MBS3902721-01 0.01 mg

Rabbit anti-NUP188 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-NUP188 Antibody, Affinity Purified
MBS3902721-02 0.1 mg

Rabbit anti-NUP188 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-NUP188 Antibody, Affinity Purified
MBS3902721-03 5x 0.01 mg

Rabbit anti-NUP188 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-NUP188 Antibody, Affinity Purified
MBS3902721-04 5x 0.1 mg

Rabbit anti-NUP188 Antibody, Affinity Purified

Sign In for Pricing
View Details
Ppdpf (NM_025598) Mouse Recombinant Protein
TP500479 20 µg

Ppdpf (NM_025598) Mouse Recombinant Protein

Sign In for Pricing
View Details
7-Oxabicyclo[2.2.1]heptane-2-sulfonyl fluoride
VXC71858-01 50 mg

7-Oxabicyclo[2.2.1]heptane-2-sulfonyl fluoride

Sign In for Pricing
View Details