Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TVP23C Peptide - middle region

TVP23C Peptide - middle region

Product Specifications

UniProt

Q96ET8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TVP23C Rabbit Polyclonal Antibody (orb327165) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RWWNHIDEDGKSHWVFESRKESSQENKTVSEAESRIFWLGLIACSVLWVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HABA 98% AR For Automatic Analysis
01318 00001 1 g

HABA 98% AR For Automatic Analysis

Sign In for Pricing
View Details
EMID1 Polyclonal Antibody, FITC Conjugated
bs-14581R-FITC 100 µL

EMID1 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Anti-SOX15 Antibody Picoband®
A07722-1 100 µg/Vial

Anti-SOX15 Antibody Picoband®

Sign In for Pricing
View Details
CLDN3 Antibody
A42085-50UL 50 μL

CLDN3 Antibody

Sign In for Pricing
View Details
CGAS Rabbit Polyclonal Antibody (Fluoro647)
orb3092012 100 µg

CGAS Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
OKCD07091-96W - PRKCB ELISA Kit (Human)
OKCD07091-96W 96 Well

OKCD07091-96W - PRKCB ELISA Kit (Human)

Sign In for Pricing
View Details