TVP23C Peptide - middle region
TVP23C Peptide - middle region
Product Specifications
UniProt
Q96ET8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TVP23C Rabbit Polyclonal Antibody (orb327165) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RWWNHIDEDGKSHWVFESRKESSQENKTVSEAESRIFWLGLIACSVLWVI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7074567 Inquire
Recombinant Sphingopyxis alaskensis Large-conductance mechanosensitive channel (mscL), partial
Sign In for Pricing
View Details 
39585121 3x 1.0µg DNA
RILPL1 CRISPRa sgRNA lentivector (set of three targets)(Human)
Sign In for Pricing
View Details 
ARP74094_P050-FITC 100 µL
NFATC2IP Antibody - N-terminal region : FITC (ARP74094_P050-FITC)
Sign In for Pricing
View Details