Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TVP23C Peptide - middle region

TVP23C Peptide - middle region

Product Specifications

UniProt

Q96ET8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TVP23C Rabbit Polyclonal Antibody (orb327165) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RWWNHIDEDGKSHWVFESRKESSQENKTVSEAESRIFWLGLIACSVLWVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PPAR-alpha (Peroxisome Proliferator Activated Receptor Alpha) ELISA Kit
MBS2506110-01 24 Tests (Limit 1)

Human PPAR-alpha (Peroxisome Proliferator Activated Receptor Alpha) ELISA Kit

Sign In for Pricing
View Details
Human PPAR-alpha (Peroxisome Proliferator Activated Receptor Alpha) ELISA Kit
MBS2506110-02 48 Tests

Human PPAR-alpha (Peroxisome Proliferator Activated Receptor Alpha) ELISA Kit

Sign In for Pricing
View Details
Human PPAR-alpha (Peroxisome Proliferator Activated Receptor Alpha) ELISA Kit
MBS2506110-03 96 Tests

Human PPAR-alpha (Peroxisome Proliferator Activated Receptor Alpha) ELISA Kit

Sign In for Pricing
View Details
Human PPAR-alpha (Peroxisome Proliferator Activated Receptor Alpha) ELISA Kit
MBS2506110-04 5x 96 Tests

Human PPAR-alpha (Peroxisome Proliferator Activated Receptor Alpha) ELISA Kit

Sign In for Pricing
View Details
Human PPAR-alpha (Peroxisome Proliferator Activated Receptor Alpha) ELISA Kit
MBS2506110-05 10x 96 Tests

Human PPAR-alpha (Peroxisome Proliferator Activated Receptor Alpha) ELISA Kit

Sign In for Pricing
View Details
Czib Mouse shRNA Lentiviral Particle (Locus ID 74098)
TL511071V 500 µL Each

Czib Mouse shRNA Lentiviral Particle (Locus ID 74098)

Sign In for Pricing
View Details