FAM47E Peptide - middle region
FAM47E Peptide - middle region
Product Specifications
UniProt
Q6ZV65
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FAM47E Rabbit Polyclonal Antibody (orb587830) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KLEDTWAYCQDTRKGMKEPTKLLKKHSTQVYLGPSKKTSVSNAGQWLYEE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC042810-500 1x 500 µL
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/2810R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LY422563 100 µg
Argininosuccinate Lyase (ASL) (NM_001024944) Human Over-expression Lysate
Sign In for Pricing
View Details