FAM47E Peptide - middle region
FAM47E Peptide - middle region
Product Specifications
UniProt
Q6ZV65
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FAM47E Rabbit Polyclonal Antibody (orb587830) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KLEDTWAYCQDTRKGMKEPTKLLKKHSTQVYLGPSKKTSVSNAGQWLYEE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP50690PU-N 400 µL
C9orf95 (NMRK1) (N-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
BNC401025-100 1x 100 µL
ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 