Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR89A Peptide - C-terminal region

GPR89A Peptide - C-terminal region

Product Specifications

UniProt

B7ZAQ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR89A Rabbit Polyclonal Antibody (orb587836) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EYRTIITEVLGELQFNFYHRWFDVIFLVSALSSILFLYLAHKQAPEKQMA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Corynebacterium Diphtheriae upp Protein (aa 1-211)
VAng-Lsx2898-1mgEcoli 1 mg (E. coli)

Recombinant Corynebacterium Diphtheriae upp Protein (aa 1-211)

Sign In for Pricing
View Details
IL17E (IL25) (NM_172314) Human Tagged ORF Clone Lentiviral Particle
RC220754L3V 200 µL

IL17E (IL25) (NM_172314) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Glutathione S Transferase Alpha 1 (GSTa1)
TRV-0022432-01 200 µL

FITC-Linked Polyclonal Antibody to Glutathione S Transferase Alpha 1 (GSTa1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Glutathione S Transferase Alpha 1 (GSTa1)
TRV-0022432-02 1 mL

FITC-Linked Polyclonal Antibody to Glutathione S Transferase Alpha 1 (GSTa1)

Sign In for Pricing
View Details
MOB1A Polyclonal Antibody
MBS2560832-01 0.02 mL

MOB1A Polyclonal Antibody

Sign In for Pricing
View Details
MOB1A Polyclonal Antibody
MBS2560832-02 0.06 mL

MOB1A Polyclonal Antibody

Sign In for Pricing
View Details