Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR89A Peptide - C-terminal region

GPR89A Peptide - C-terminal region

Product Specifications

UniProt

B7ZAQ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR89A Rabbit Polyclonal Antibody (orb587836) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EYRTIITEVLGELQFNFYHRWFDVIFLVSALSSILFLYLAHKQAPEKQMA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OIH Antibody, Biotin conjugated
A50287-50UG 50 µg

OIH Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit Anti Human TYR PolyClonal Antibody
MBS1491242-01 0.1 mL

Rabbit Anti Human TYR PolyClonal Antibody

Sign In for Pricing
View Details
Rabbit Anti Human TYR PolyClonal Antibody
MBS1491242-02 5x 0.1 mL

Rabbit Anti Human TYR PolyClonal Antibody

Sign In for Pricing
View Details
MRPS12 Protein Lysate
OCOA07113-20UG 20 µg

MRPS12 Protein Lysate

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3080), CF488A conjugate, 0.1mg/mL
BNC883080-500 1x 500 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3080), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Nematostella vectensis Eukaryotic translation initiation factor 3 subunit E (v1g163572)
MBS1061382-01 0.02 mg (E-Coli)

Recombinant Nematostella vectensis Eukaryotic translation initiation factor 3 subunit E (v1g163572)

Sign In for Pricing
View Details