Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTF2H2 Peptide - N-terminal region

GTF2H2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

P44, BTF2, TFIIH, BTF2P44, T-BTF2P44

UniProt

Q13888

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GTF2H2 Rabbit Polyclonal Antibody (orb587837) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001506.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D-Homotyrosine hydrobromide
MBS9022578-01 1 g

D-Homotyrosine hydrobromide

Sign In for Pricing
View Details
D-Homotyrosine hydrobromide
MBS9022578-02 5x 1 g

D-Homotyrosine hydrobromide

Sign In for Pricing
View Details
SPATA13 HDR Plasmid (m)
sc-432348-HDR 20 µg

SPATA13 HDR Plasmid (m)

Sign In for Pricing
View Details
UACA Rabbit Polyclonal Antibody (FITC)
orb2095329 100 µL

UACA Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
P35 Recombinant Rabbit mAb
orb3184998-01 25 µL

P35 Recombinant Rabbit mAb

Sign In for Pricing
View Details
P35 Recombinant Rabbit mAb
orb3184998-02 50 µL

P35 Recombinant Rabbit mAb

Sign In for Pricing
View Details