Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTF2H2 Peptide - N-terminal region

GTF2H2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

P44, BTF2, TFIIH, BTF2P44, T-BTF2P44

UniProt

Q13888

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GTF2H2 Rabbit Polyclonal Antibody (orb587837) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001506.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOX (NM_002317) Human Recombinant Protein
TP313323 20 µg

LOX (NM_002317) Human Recombinant Protein

Sign In for Pricing
View Details
Monoclonal Antibody to Collagen Type I Alpha 1 (COL1a1)
TRV-0033420-01 20 µL

Monoclonal Antibody to Collagen Type I Alpha 1 (COL1a1)

Sign In for Pricing
View Details
Monoclonal Antibody to Collagen Type I Alpha 1 (COL1a1)
TRV-0033420-02 100 µL

Monoclonal Antibody to Collagen Type I Alpha 1 (COL1a1)

Sign In for Pricing
View Details
Monoclonal Antibody to Collagen Type I Alpha 1 (COL1a1)
TRV-0033420-03 200 µL

Monoclonal Antibody to Collagen Type I Alpha 1 (COL1a1)

Sign In for Pricing
View Details
Monoclonal Antibody to Collagen Type I Alpha 1 (COL1a1)
TRV-0033420-04 1 mL

Monoclonal Antibody to Collagen Type I Alpha 1 (COL1a1)

Sign In for Pricing
View Details
Human Uveal autoantigen with coiled-coil domains and ankyrin repeats (UACA) ELISA Kit
abx251601 96 Well

Human Uveal autoantigen with coiled-coil domains and ankyrin repeats (UACA) ELISA Kit

Sign In for Pricing
View Details