Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTF2H2 Peptide - N-terminal region

GTF2H2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

P44, BTF2, TFIIH, BTF2P44, T-BTF2P44

UniProt

Q13888

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GTF2H2 Rabbit Polyclonal Antibody (orb587837) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001506.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMS345541 hydrochloride
A3248-5 5 mg

BMS345541 hydrochloride

Sign In for Pricing
View Details
TRAF3IP2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2433008 1.0 µg DNA

TRAF3IP2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Hydroxyproline HYP ELISA Kit
BG-HUM11137 1 Each

Hydroxyproline HYP ELISA Kit

Sign In for Pricing
View Details
KRT17P1 Protein Vector (Human) (pPM-C-His)
PV089469 500 ng

KRT17P1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
HPV16 E6 + HPV18 E6 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb913042 100 µL

HPV16 E6 + HPV18 E6 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
Rabbit Anti Human MCM5 Polyclonal Affinity Purified (PBS with 0.05% Proclin300 and 50% glycerol, pH7.4.) (IHC)
IRBAHUMCM5AP234120UL 1 Each

Rabbit Anti Human MCM5 Polyclonal Affinity Purified (PBS with 0.05% Proclin300 and 50% glycerol, pH7.4.) (IHC)

Sign In for Pricing
View Details