Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGLC7 Peptide - middle region

IGLC7 Peptide - middle region

Product Specifications

UniProt

A0M8Q6

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IGLC7 Rabbit Polyclonal Antibody (orb587838) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Betatrophin (123-198) (Human)
051-64 100 µg

Betatrophin (123-198) (Human)

Sign In for Pricing
View Details
MPB-VC-PAB-DM1
orb2944315-01 50 mg

MPB-VC-PAB-DM1

Sign In for Pricing
View Details
MPB-VC-PAB-DM1
orb2944315-02 10 mg

MPB-VC-PAB-DM1

Sign In for Pricing
View Details
Cat Cyclin B ELISA Kit
MBS086292 Inquire

Cat Cyclin B ELISA Kit

Sign In for Pricing
View Details
Human GATA1 Protein Lysate
MBS8412126-01 0.02 mg

Human GATA1 Protein Lysate

Sign In for Pricing
View Details
Human GATA1 Protein Lysate
MBS8412126-02 5x 0.02 mg

Human GATA1 Protein Lysate

Sign In for Pricing
View Details