Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGLC7 Peptide - middle region

IGLC7 Peptide - middle region

Product Specifications

UniProt

A0M8Q6

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IGLC7 Rabbit Polyclonal Antibody (orb587838) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROC1 (BSA & Azide Free) discontinued
R2997-80X-ML750 100 µL

ROC1 (BSA & Azide Free) discontinued

Sign In for Pricing
View Details
Cholinergic Receptor, Nicotinic, Beta 2 (CHRNb2) Antibody
abx171732 1 mL

Cholinergic Receptor, Nicotinic, Beta 2 (CHRNb2) Antibody

Sign In for Pricing
View Details
MTF-1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-3601R-BF488 100 µL

MTF-1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
HSPA2 Rabbit mAb
E38A4326 100 µg -100 µL

HSPA2 Rabbit mAb

Sign In for Pricing
View Details
TRMT1L CRISPR All-in-one AAV vector set (with saCas9)(Human)
47868151 3x 1.0 µg DNA

TRMT1L CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
TMA16 (NM_018352) Human Recombinant Protein
TP760744 50 µg

TMA16 (NM_018352) Human Recombinant Protein

Sign In for Pricing
View Details