Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLLN Peptide - C-terminal region

KLLN Peptide - C-terminal region

Product Specifications

Product Name Alternative

KILLIN

UniProt

B2CW77

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLLN Rabbit Polyclonal Antibody (orb587839) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001119521

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGNWLHKHPHPNTCPRLPACWLPPILTERGERVPKLVPLLACYPKSKPKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

20Beta-Dihydrocortisol 21-Acetate
TRC-D448746-50MG 50 mg

20Beta-Dihydrocortisol 21-Acetate

Sign In for Pricing
View Details
L-Allo-isoleucine-d10
TRC-A548202-25MG 25 mg

L-Allo-isoleucine-d10

Sign In for Pricing
View Details
FLIP (CFLAR) (1-376) Mouse Monoclonal Antibody [Clone ID: AT8B12]
AM09055PU-S 50 µL

FLIP (CFLAR) (1-376) Mouse Monoclonal Antibody [Clone ID: AT8B12]

Sign In for Pricing
View Details
APEX2 Antibody
KC-7307-01 50 μL

APEX2 Antibody

Sign In for Pricing
View Details
APEX2 Antibody
KC-7307-02 100 µL

APEX2 Antibody

Sign In for Pricing
View Details
APEX2 Antibody
KC-7307-03 1 mL

APEX2 Antibody

Sign In for Pricing
View Details