Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLLN Peptide - C-terminal region

KLLN Peptide - C-terminal region

Product Specifications

Product Name Alternative

KILLIN

UniProt

B2CW77

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLLN Rabbit Polyclonal Antibody (orb587839) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001119521

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGNWLHKHPHPNTCPRLPACWLPPILTERGERVPKLVPLLACYPKSKPKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCL28 (NM_001301873) Human Tagged ORF Clone
RG235853 10 µg

CCL28 (NM_001301873) Human Tagged ORF Clone

Sign In for Pricing
View Details
Selonsertib
TRC-S253800-10MG 10 mg

Selonsertib

Sign In for Pricing
View Details
N-Phthaloyl-L-glutamic Anhydride
TRC-P394400-2.5G 2.5 g

N-Phthaloyl-L-glutamic Anhydride

Sign In for Pricing
View Details
Tmem71 Mouse Gene Knockout Kit (CRISPR)
KN517896 1 Kit

Tmem71 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Spink13 Mouse Gene Knockout Kit (CRISPR)
KN516614 1 Kit

Spink13 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (C3), CF647 conjugate, 0.1mg/mL
BNC470354-500 1x 500 µL

AFP (Alpha Fetoprotein) (C3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details