Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF737 Peptide - N-terminal region

ZNF737 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ZNF102

UniProt

O75373

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF737 Rabbit Polyclonal Antibody (orb587851) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001152765

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FQKVTLRRYENYGHDNLQFKKGCESVDECKVHKRGYNGLNQYLTTTQSKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLTF Rabbit Monoclonal Antibody [Clone ID: 23GB2485]
TA424848 100 µL

HLTF Rabbit Monoclonal Antibody [Clone ID: 23GB2485]

Sign In for Pricing
View Details
Chicken NE ELISA Kit
ECKN0013 96 Tests

Chicken NE ELISA Kit

Sign In for Pricing
View Details
TMEM140 Polyclonal Antibody, Biotin Conjugated
A63587-050 50 µL

TMEM140 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
7,12-Dimethylbenz[a]anthracene (DMBA)
E1022-25mg 25 mg

7,12-Dimethylbenz[a]anthracene (DMBA)

Sign In for Pricing
View Details
Goat Pancreatic Amylase ELISA Kit
MBS753151-01 48 Well

Goat Pancreatic Amylase ELISA Kit

Sign In for Pricing
View Details
Goat Pancreatic Amylase ELISA Kit
MBS753151-02 96 Well

Goat Pancreatic Amylase ELISA Kit

Sign In for Pricing
View Details